Jdp2 Rabbit Polyclonal Antibody TA329961 from OriGene Technologies | Biocompare.com

Supplier Images

Jdp2 Rabbit Polyclonal Antibody

Be the first to write a review!

Supplier Page from
OriGene Technologies for
Jdp2 Rabbit Polyclonal Antibody

The Jdp2 Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to JDP2. This antibody recognizes Mouse antigen. The Jdp2 Rabbit Polyclonal Antibody has been validated for the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-Jundm2 Antibody

Product Specs
ItemJdp2 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberTA329961
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
ReactivityMouse
TargetJdp2
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-Jundm2 antibody: synthetic peptide directed towards the c terminal of mouse Jundm2. Synthetic peptide located within the following region: LKTQIEELKLERQQLILMLNRHRPTCIVRTDSVRTPESEGNPLLEQLDKK
NCBI Full Gene NameJun dimerization protein 2
NCBI Gene AliasesTIF, Jundm, Jundp2, Jundm2, TI
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!